PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00185g01625.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 272aa    MW: 30599.5 Da    PI: 7.8397
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00185g01625.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.99.8e-333185155
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              kprlrWt +LHe+Fveav++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Peaxi162Scf00185g01625.1 31 KPRLRWTADLHEHFVEAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 85
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.9832888IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-312886IPR009057Homeodomain-like
SuperFamilySSF466893.05E-163188IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-243186IPR006447Myb domain, plants
PfamPF002491.3E-83384IPR001005SANT/Myb domain
PfamPF143791.2E-21131176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MYNASELGGG SGFMYENGNG EGGIVMTRDP KPRLRWTADL HEHFVEAVTK LGGPDKATPK  60
SVLRLMGLKG LTLYHLKSHL QKYRLGQQAK KQNAADHNKE NSGDSSGHFS LHSRGPSTSS  120
LSMNYMQGEV PISEAVMCQI EVQKRLQEQL EVQQKLQMRI EAQGKYLQAM LEKAQKNLPV  180
SMNSPSALEA TRAQQFNLPL SNITDHLHGD NRDDTIMGKR IYDNTMDELP RSDYFKEEDQ  240
KRDMNLKLKE ASITFDLNSR SSYDFFGANT AV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769429.11e-137PREDICTED: myb family transcription factor APL isoform X2
RefseqXP_016486019.11e-137PREDICTED: myb family transcription factor APL-like isoform X2
SwissprotQ9SAK52e-51APL_ARATH; Myb family transcription factor APL
TrEMBLK4CMW81e-124K4CMW8_SOLLC; Uncharacterized protein
TrEMBLM1AJD61e-126M1AJD6_SOLTU; Uncharacterized protein
STRINGSolyc08g076010.2.11e-124(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44162139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-62G2-like family protein